KEGG   Bacillus sp. YP1: QF06_13285
Entry
QF06_13285        CDS       T03701                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00780  Biotin metabolism
bacy01100  Metabolic pathways
bacy01240  Biosynthesis of cofactors
Module
bacy_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    QF06_13285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bacy00199]
    QF06_13285
Enzymes [BR:bacy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     QF06_13285
Cytochrome P450 [BR:bacy00199]
 Cytochrome P450, bacteria type
  CYP107 family
   QF06_13285
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: AJO60754
LinkDB
Position
complement(2702563..2703750)
AA seq 395 aa
MTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETATILKDARFKVR
TPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRATESYQPYIIETVHHLL
DQVQGEKKMEVISDFAFPLASFVIANIVGVPEEDREQLKEWAASLIQTIDFTRSRKALTE
GNHMAVQAMAYFKELIQKRKRHPQQDMISMLLKGKENDKLTEEEAASTCILLAIAGHETT
VNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDISGVTI
RQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNQHLSFGHGHHVCLGSSLARLEAQIAIN
TLLQRMPSLKLADFEWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgacaattgcatcgtcaactgcatcttctgagtttttgaaaaacccatattctttttac
gacacattgcgagctgttcatcctatctataaagggagtttcttaaaatacccgggctgg
tatgtcacaggatatgaagaaacggctactattttgaaagatgcgagattcaaagtccgc
accccgctgcctgagagctcgaccaaatatcaggacctttcacatgtgcaaaatcaaatg
atgctgtttcagaaccagcctgatcatagacgattgcggacgcttgccagcggagcgttt
acgccgagagcgacagagagttatcagccgtatatcattgaaactgtccatcatttgctt
gatcaagtgcaaggtgaaaaaaagatggaggtcatttcggactttgcttttcctttagca
agctttgtcatagctaacattgtaggtgtaccggaggaagatagggagcaattaaaggag
tgggctgcgagtctcattcaaacgattgattttacccggtcaagaaaggcattaacagag
ggcaatcatatggctgtgcaggctatggcatatttcaaagagctgattcaaaagcgaaaa
cgccaccctcaacaggatatgatcagcatgctcttgaaggggaaagaaaatgataagctg
acggaagaggaggcggcatctacgtgcatattgctggcgatcgccggacatgagacaacg
gttaatctcatcagcaattcagtcctttgtctgctgcagcatccagaacagcttttgaaa
ctgagagaaaatccagatcttattggtaccgcagttgaggaatgtttacgctatgaaagc
cccacgcaaatgacagccagagttgcgtcagaggatattgacatcagcggggtgacgatt
cgtcaaggagaacaagtctatcttttgttaggagcggctaatcgagacccaagcattttc
acgaaccccgatgtcttcgatattacgagaagtcctaatcagcatctttcattcggtcat
ggccatcatgtttgtttagggtcctcgctggcacgattagaagcgcaaattgcgattaac
actcttctgcagcggatgcccagccttaagctcgcggattttgaatggcggtatcggccg
ctttttggatttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system