Burkholderia aenigmatica: L3V59_00380 Help Entry L3V59_00380       CDS       T09543                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism baen  Burkholderia aenigmatica Brite KEGG Orthology (KO) [BR:baen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:baen03032]     L3V59_00380    03036 Chromosome and associated proteins [BR:baen03036]     L3V59_00380    03400 DNA repair and recombination proteins [BR:baen03400]     L3V59_00380 DNA replication proteins [BR:baen03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     L3V59_00380 Chromosome and associated proteins [BR:baen03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     L3V59_00380 DNA repair and recombination proteins [BR:baen03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       L3V59_00380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 DUF2267 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  UKD11579 LinkDB All DBs Position 1:complement(79051..79329) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAAQTGASKAQTGETLDTLLEVIKKAVSKGDAVQLIGFGSFGSGKRAARTG RNPKTGETIKIPAAKTVKFTAGKAFKDAVNKR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccgcccaaacgggcgctagcaaggctcaa accggcgaaacgctggacacgctgctcgaagtcatcaagaaggccgtgtcgaagggtgat gcggttcagctgatcggcttcggcagcttcggttcgggcaagcgcgcagcacgtacgggc cgcaacccgaagaccggcgaaaccatcaagatcccggcagccaagacggtcaagttcacg gctggcaaggcgttcaaggacgccgtcaacaagcgttaa

DBGET integrated database retrieval system