Burkholderia aenigmatica: L3V59_05595 Help Entry L3V59_05595       CDS       T09543                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism baen  Burkholderia aenigmatica Pathway baen00998   Biosynthesis of various antibiotics baen01100   Metabolic pathways baen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:baen00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L3V59_05595 (acpP)    00074 Mycolic acid biosynthesis     L3V59_05595 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L3V59_05595 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  UKD12532 LinkDB All DBs Position 1:1161281..1161520 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacatcgaacaacgtgtcaagaagatcgtcgctgaacaactgggcgtcgcggaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgccgactcgctcgacacc gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgaccgttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system