Burkholderia aenigmatica: L3V59_30355 Help Entry L3V59_30355       CDS       T09543                                  Name (GenBank) MmoB/DmpM family protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism baen  Burkholderia aenigmatica Pathway baen00361   Chlorocyclohexane and chlorobenzene degradation baen00362   Benzoate degradation baen00623   Toluene degradation baen01100   Metabolic pathways baen01120   Microbial metabolism in diverse environments baen01220   Degradation of aromatic compounds Module baen_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:baen00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     L3V59_30355    00361 Chlorocyclohexane and chlorobenzene degradation     L3V59_30355    00623 Toluene degradation     L3V59_30355 Enzymes [BR:baen01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      L3V59_30355     1.14.13.244  phenol 2-monooxygenase (NADH)      L3V59_30355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  UKD13986 LinkDB All DBs Position 2:2701774..2702043 Genome browser AA seq 89 aa AA seqDB search MSNVFIAFQANEESRPIVEAIVADNPLAVVVESPGMVKIDSPDRLTIRRETIEELTGTRF DLQQLQVNLITLSGHIDEDDDQFTLSWSH NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccaacgtattcatcgccttccaggccaatgaggagtccagaccgatcgtcgaggcg atcgtcgccgacaacccgctcgcggtggtggtcgagtcgcccgggatggtcaagatcgat tcgcccgaccggctgacgatccgccgcgaaacgatcgaggaactgaccggcacgcgtttc gacctgcagcagcttcaggtgaacctgatcacgctgtccggccatatcgacgaggacgac gaccagttcacgctgagctggtcgcactga

DBGET integrated database retrieval system