Burkholderia aenigmatica: L3V59_30365 Help Entry L3V59_30365       CDS       T09543                                  Name (GenBank) phenol hydroxylase subunit P4   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism baen  Burkholderia aenigmatica Pathway baen00361   Chlorocyclohexane and chlorobenzene degradation baen00362   Benzoate degradation baen00623   Toluene degradation baen01100   Metabolic pathways baen01120   Microbial metabolism in diverse environments baen01220   Degradation of aromatic compounds Module baen_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:baen00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     L3V59_30365    00361 Chlorocyclohexane and chlorobenzene degradation     L3V59_30365    00623 Toluene degradation     L3V59_30365 Enzymes [BR:baen01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      L3V59_30365     1.14.13.244  phenol 2-monooxygenase (NADH)      L3V59_30365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  UKD13988 LinkDB All DBs Position 2:2703713..2704069 Genome browser AA seq 118 aa AA seqDB search MAVIALKPYDFPIKDAVGKFPAPLLYVCWEDHLMFPAPFCLPLPPDLPFGALARDVLPPV YGYHPDFAKIDWDRVEWFRSGEPWAPDAEKSLAGNGLGHKDLISFRTPGLDGLGGASF NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccgtcatcgcgctcaaaccctacgacttcccgatcaaggacgcggtcgggaagttt cccgcaccgctgctctacgtgtgctgggaagaccacctgatgttcccggcgccgttctgc ctgccgctgccgccggacctgccgttcggcgcgctcgcgcgcgacgtgctgccgcccgtc tacggctaccacccggatttcgcgaagatcgactgggatcgcgtcgagtggttccgctcg ggcgagccctgggcgccggacgcggagaagagcctggccggcaacggcctcgggcacaag gacctgatcagcttccgcacgccgggcctcgacggcctcggcggcgcgagcttctga

DBGET integrated database retrieval system