Burkholderia aenigmatica: L3V59_36280 Help Entry L3V59_36280       CDS       T09543                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism baen  Burkholderia aenigmatica Brite KEGG Orthology (KO) [BR:baen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:baen03036]     L3V59_36280    03400 DNA repair and recombination proteins [BR:baen03400]     L3V59_36280 Chromosome and associated proteins [BR:baen03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     L3V59_36280 DNA repair and recombination proteins [BR:baen03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       L3V59_36280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N RIP_P131-like YL1_C TPX2 Motif Other DBs NCBI-ProteinID:  UKD17404 LinkDB All DBs Position 3:264357..264647 Genome browser AA seq 96 aa AA seqDB search MPTYKELLMQRAKIEAQIETKRQEEVAAVIAQIRKLMAEYELNVDDIAPPRRRGSKRTGK PLPPKYRDPKTGATWSGRGRAPHWLGKNRTRYLIEA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccgacctacaaagaactgcttatgcaacgcgcgaagatcgaggcgcaaatcgagaca aagcggcaagaggaagttgctgccgtcatcgcccaaatccgcaaactgatggccgagtac gagctgaacgtcgatgatattgcgccaccgcgccgccgtggcagcaagcgcacaggcaag ccgctcccaccgaaataccgcgacccgaagaccggtgccacctggtccgggcgcgggcgc gctccacactggctgggtaagaatcgaacgcgctatctcatcgaagcttga

DBGET integrated database retrieval system