Borrelia afzelii (FLI): BAPKO_0747 Help Entry BAPKO_0747        CDS       T00383                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism baf  Borrelia afzelii (FLI) Pathway baf01100   Metabolic pathways baf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:baf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BAPKO_0747    00074 Mycolic acid biosynthesis     BAPKO_0747   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BAPKO_0747 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  ABH01977 UniProt:  Q0SMF1 LinkDB All DBs Position 744245..744487 Genome browser AA seq 80 aa AA seqDB search MDNDEIFSKVRSIISEQLDKKEDEITIDSRFVEDLNADSLDIYELLYLLEEAFDDKIPEN EANEFETVGDVVNFIKKRKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggataatgatgaaatttttagcaaggttagatctattatatctgagcagcttgataaa aaagaagatgaaattactatagactccagatttgttgaggatcttaatgcagatagtctt gatatttatgagcttttatatttgcttgaagaggcttttgatgataagatcccggagaac gaagccaatgaatttgagacggtaggcgatgttgttaattttattaaaaagagaaaaggt tga

DBGET integrated database retrieval system