Bacillus sp. FCW2: K3G25_12685 Help Entry K3G25_12685       CDS       T10657                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism bafc  Bacillus sp. FCW2 Pathway bafc00030   Pentose phosphate pathway bafc00051   Fructose and mannose metabolism bafc00710   Carbon fixation by Calvin cycle bafc01100   Metabolic pathways bafc01110   Biosynthesis of secondary metabolites bafc01120   Microbial metabolism in diverse environments bafc01200   Carbon metabolism bafc01230   Biosynthesis of amino acids Module bafc_M00004   Pentose phosphate pathway (Pentose phosphate cycle) bafc_M00007   Pentose phosphate pathway, non-oxidative phase, fructose-6P => ribose-5P Brite KEGG Orthology (KO) [BR:bafc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     K3G25_12685 (rpiB)    00051 Fructose and mannose metabolism     K3G25_12685 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     K3G25_12685 (rpiB) Enzymes [BR:bafc01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      K3G25_12685 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  UHC63631 LinkDB All DBs Position complement(2520647..2521096) Genome browser AA seq 149 aa AA seqDB search MKVAIASDHGGVHIREEIKSLLDELQIEYIDMGCECGAGSVDYSDYAFPVAEKVVNGEAD RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREI AKVWLTTEFTGGRHERRIGKIADYEEKNL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagctattgcgtcagatcacggcggcgtccatatccgcgaagaaataaaaagt cttttggatgaattgcagattgaatacattgatatgggctgtgaatgcggcgccggctct gtcgattattcagactacgcttttccggtagcggaaaaagtggtgaacggcgaagctgac aggggaattttaatttgcggcacaggcatcggcatgagcatctccgcaaataaggtaaag ggcatacgctgtgcgcttgcccatgacaccttcagcgcaaaagcgacgcgtgaacacaat gacacgaatgttcttgcgatgggcgaacgcgtcatcggcccggggctggcgcgcgaaatc gcaaaagtctggctgacgactgaatttacgggcggccgccacgaacggcggatcggcaaa atcgcagattacgaagaaaaaaatctgtaa

DBGET integrated database retrieval system