Borreliella afzelii Tom3107: P612_03630 Help Entry P612_03630        CDS       T03256                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism baft  Borreliella afzelii Tom3107 Pathway baft01100   Metabolic pathways baft01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:baft00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P612_03630    00074 Mycolic acid biosynthesis     P612_03630   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P612_03630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  AIK18992 LinkDB All DBs Position 742800..743042 Genome browser AA seq 80 aa AA seqDB search MDNDEIFSKVRSIISEQLDKKEDEITIDSRFVEDLNADSLDIYELLYLLEEAFDDKIPEN EANEFETVGDVVNFIKKRKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggataatgatgaaatttttagcaaggttagatctattatatctgagcagcttgataaa aaagaagatgaaattactatagactccagatttgttgaggatcttaatgcagatagtctt gatatttatgagcttttgtatttgcttgaagaggcttttgatgataagatcccggagaac gaagccaatgaatttgagacggtaggcgatgttgttaattttattaaaaagagaaaaggt tga

DBGET integrated database retrieval system