Brevibacillus agri: BA6348_13110
Help
Entry
BA6348_13110 CDS
T05855
Name
(GenBank) hypothetical protein
KO
K14475
inhibitor of cysteine peptidase
Organism
bagr
Brevibacillus agri
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Inhibitor_I42
Motif
Other DBs
NCBI-ProteinID:
QAV16047
LinkDB
All DBs
Position
complement(2613381..2613689)
Genome browser
AA seq
102 aa
AA seq
DB search
MAMISTYTLQVQSGQPFAVTLDANPTTGYQWALSNSVDETFLFLQSSEFVPPSQPARIGQ
GGQQRFTFRALRRGVTSLSFKYCRPWEPSDCASFVFYVVTVV
NT seq
309 nt
NT seq
+upstream
nt +downstream
nt
atggcgatgatctcgacttatacgcttcaggtgcagagcggccagccgtttgcggtcacg
ctcgacgcaaatccgacgactgggtaccagtgggcactgtccaattcggtggacgagacg
tttctgtttctgcaatccagtgaatttgttccgccttcgcagcccgctcggattgggcaa
ggcggtcagcagcggttcacttttcgggcgctgcgccggggtgtgacttcgctttcgttc
aagtactgccgtccgtgggagccgtctgattgtgccagctttgttttttatgtcgttacg
gttgtgtga
DBGET
integrated database retrieval system