Bacillus anthracis CDC 684: BAMEG_2741 Help Entry BAMEG_2741        CDS       T00886                                  Name (GenBank) ACT domain protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism bah  Bacillus anthracis CDC 684 Pathway bah00290   Valine, leucine and isoleucine biosynthesis bah00650   Butanoate metabolism bah00660   C5-Branched dibasic acid metabolism bah00770   Pantothenate and CoA biosynthesis bah01100   Metabolic pathways bah01110   Biosynthesis of secondary metabolites bah01210   2-Oxocarboxylic acid metabolism bah01230   Biosynthesis of amino acids Module bah_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bah_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bah00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BAMEG_2741    00660 C5-Branched dibasic acid metabolism     BAMEG_2741   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BAMEG_2741   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BAMEG_2741 Enzymes [BR:bah01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BAMEG_2741 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT Motif Other DBs NCBI-ProteinID:  ACP16298 LinkDB All DBs Position complement(2505175..2505387) Genome browser AA seq 70 aa AA seqDB search MSHTFSLVIDNDPNVLLRISGIFARRGYYISSLNLNESEMELTAVCTEQEATLLVGQLKK LINVLQVNKL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcattagttatcgataacgatccaaatgtcttattacgtataagt ggaatttttgctcggcgtggttattatatttcttcattaaatttaaatgaaagtgaaatg gagttaacggcagtttgtacagaacaagaagcaacattactcgttggtcagttgaaaaag ttaatcaatgtactacaagtaaacaaattataa

DBGET integrated database retrieval system