Bacillus anthracis A0248: BAA_1920 Help Entry BAA_1920          CDS       T00892                                  Name (GenBank) ACT domain protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism bai  Bacillus anthracis A0248 Pathway bai00290   Valine, leucine and isoleucine biosynthesis bai00650   Butanoate metabolism bai00660   C5-Branched dibasic acid metabolism bai00770   Pantothenate and CoA biosynthesis bai01100   Metabolic pathways bai01110   Biosynthesis of secondary metabolites bai01210   2-Oxocarboxylic acid metabolism bai01230   Biosynthesis of amino acids Module bai_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine bai_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:bai00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     BAA_1920    00660 C5-Branched dibasic acid metabolism     BAA_1920   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     BAA_1920   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     BAA_1920 Enzymes [BR:bai01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      BAA_1920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT Motif Other DBs NCBI-ProteinID:  ACQ48779 LinkDB All DBs Position 1733730..1733942 Genome browser AA seq 70 aa AA seqDB search MSHTFSLVIDNDPNVLLRISGIFARRGYYISSLNLNESEMELTAVCTEQEATLLVGQLKK LINVLQVNKL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcattagttatcgataacgatccaaatgtcttattacgtataagt ggaatttttgctcggcgtggttattatatttcttcattaaatttaaatgaaagtgaaatg gagttaacggcagtttgtacagaacaagaagcaacattactcgttggtcagttgaaaaag ttaatcaatgtactacaagtaaacaaattataa

DBGET integrated database retrieval system