Bacillus cereus biovar anthracis CI: BACI_c19580 Help Entry BACI_c19580       CDS       T01279                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bal  Bacillus cereus biovar anthracis CI Pathway bal00975   Biosynthesis of various siderophores bal01100   Metabolic pathways bal01110   Biosynthesis of secondary metabolites Module bal_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:bal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     BACI_c19580  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bal01008]     BACI_c19580 Polyketide biosynthesis proteins [BR:bal01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BACI_c19580 SSDB OrthologParalogGFIT Motif Pfam:  CFAP70_helical Motif Other DBs NCBI-ProteinID:  ADK04611 LinkDB All DBs Position 1840577..1840852 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPE DEVDPKAFLTVGSLLDFMEELQPLQDVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgctgtattaaaaattatgacagaaaaaatggaattg aaaaatgtaacgcatttagaagaaacgatgcgtttaaatcaagatctatatattgattca gtaatgatgttacaactcattgtatatatagaaatggatgtaaagctatgcgttccagag gatgaggtagacccaaaagcatttcttactgtaggatctttgcttgattttatggaggag ttgcagccgttacaggacgtaaatgtgaataactaa

DBGET integrated database retrieval system