KEGG   Brevundimonas albigilva: M8231_10335
Entry
M8231_10335       CDS       T08389                                 
Name
(GenBank) helix-turn-helix domain-containing protein
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
balb  Brevundimonas albigilva
Pathway
balb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:balb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    M8231_10335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:balb03000]
    M8231_10335
   03400 DNA repair and recombination proteins [BR:balb03400]
    M8231_10335
Enzymes [BR:balb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     M8231_10335
Transcription factors [BR:balb03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    M8231_10335
DNA repair and recombination proteins [BR:balb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     M8231_10335
SSDB
Motif
Pfam: Ada_Zn_binding AlkA_N HTH_18 HTH_AraC
Other DBs
NCBI-ProteinID: URI14220
UniProt: A0ABY4SJN7
LinkDB
Position
complement(2058402..2059529)
AA seq 375 aa
MNSSLDFETCWRAVVARDARFDGRFFTGVTSTGIYCRPVCPARTPRRENVTFHPSAAAAE
AGGFRACLRCRPETAPDFAGWRGVEAPRGGAWRGSSNTVSRALALIEGGALDGGDVDALA
ARLGVGERQLRRLFRQHLGAAPVSVAQTRRVLLAKQLIHETGLSMAEIALASGFGSVRRF
NETFQGLYGRPPSALRRRRTGEAGGTIRLGLSYRAPYDWPAMLASLAARSAMPETVSGDA
WTRMLAPQVDGARGRISVRPDAGASERLTAEVEIDALCALPGVLARTRRVLDLAADPVAI
ARDLSTDPVLAEAVAAHPGRRPPGEWSDAGDDPPSDRLTTDDPMLRARAERWRPWRAYGA
LYWTLAKETLNAQAA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgaactcttcgctggatttcgagacctgctggcgcgccgtcgtggcgcgcgacgcccgc
ttcgacgggcgattcttcaccggcgtgacgtcgacgggaatctattgccggccggtgtgc
ccggcgcgcacgccccggcgcgagaacgtgaccttccaccccagcgcggcggcggccgag
gccgggggctttcgcgcctgcctgcgctgccgcccggagacggcgcccgacttcgccgga
tggcgcggcgtcgaagcgccgcgcggcggggcctggcggggatcgtccaacaccgtcagc
cgcgccctggccctgatcgagggcggggcgctggacgggggcgacgtcgacgccctggcc
gcgcggctgggggtgggagaacggcagctgcgccgtctgttccgccagcacctgggggcc
gcccccgtcagcgtggcccagacgcggcgcgtgctcctggccaagcagctgatccacgag
accggcctgtcgatggccgagatcgccttggcctcgggcttcggcagcgtgcggcggttc
aacgagaccttccagggcctgtacggacgcccgccgtcggcgctgcggcgacgccgcacg
ggggaggcagggggaacgatccggctaggcctcagctaccgcgccccctatgactggccg
gccatgctggcgtcgctggccgcccggtcggccatgcccgaaaccgtgtcgggcgacgcc
tggacccgcatgctggcgccgcaggtcgatggcgcgcgcggccggatctcggttcggccg
gacgccggggcgtcggagcggctgaccgccgaggtcgagatcgacgcgctttgcgccctg
ccgggggtcctggcgcggacgcggcgggtgctggacctggcggcggaccctgtcgccatc
gcccgcgacctgtcgaccgatccggtcctggccgaggcggtggccgcccatccgggacgc
aggccgccgggcgagtggagcgacgcgggcgacgacccgcccagcgaccgtctgacgacc
gacgacccgatgctgcgcgcgcgcgcggaacgctggcggccctggcgggcctatggcgcg
ctgtactggaccctggccaaggagaccctgaatgcccaggccgcatga

DBGET integrated database retrieval system