Brevundimonas albigilva: M8231_11175 Help Entry M8231_11175       CDS       T08389                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism balb  Brevundimonas albigilva Pathway balb01100   Metabolic pathways balb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:balb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M8231_11175    00074 Mycolic acid biosynthesis     M8231_11175   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M8231_11175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  URI14381 LinkDB All DBs Position complement(2229611..2229850) Genome browser AA seq 79 aa AA seqDB search MSDTLERVRKIVIDHLDADPDKVTEKASFIDDLGADSLDNVELVMAFEEEFDIEIPDDAA EHIQTVGDAVKYIDEKSAG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaccctcgagcgcgttcgcaagatcgtcatcgaccacctggacgccgatccg gacaaggtcacggaaaaggccagcttcatcgacgacctgggcgccgactcgctcgacaac gtcgagctggtgatggccttcgaagaagaattcgacatcgaaatccccgacgacgccgcc gaacacatccagacggtcggcgacgccgtgaagtacatcgacgaaaagtcggccggctga

DBGET integrated database retrieval system