Bartonella alsatica: HWV54_03435 Help Entry HWV54_03435       CDS       T06670                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bals  Bartonella alsatica Brite KEGG Orthology (KO) [BR:bals00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bals03036]     HWV54_03435    03400 DNA repair and recombination proteins [BR:bals03400]     HWV54_03435 Chromosome and associated proteins [BR:bals03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     HWV54_03435 DNA repair and recombination proteins [BR:bals03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       HWV54_03435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Topoisom_I_N ComJ Motif Other DBs NCBI-ProteinID:  QLC51956 LinkDB All DBs Position complement(830506..830793) Genome browser AA seq 95 aa AA seqDB search MNNLKNMDFYELQEMRAQIDVELKKRQAKEKQNARRKILEIASAHGIDIADLASKERHYR NPNNQWELWNGRGRRPKWIKEWLESGYTLEELEVT NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaataacctcaaaaatatggatttttatgagctacaagagatgcgtgcccaaatcgat gtggaattgaaaaaacgacaagcaaaagaaaaacagaatgcacggcgaaaaattcttgaa attgctagtgcacatggaattgatattgctgatcttgcaagtaaagaacgtcattataga aatcccaataaccaatgggaattatggaatgggcgtgggcgtagacctaagtggattaaa gaatggttggaaagcggttatacgcttgaagaactagaagtaacataa

DBGET integrated database retrieval system