Bartonella alsatica: HWV54_06135 Help Entry HWV54_06135       CDS       T06670                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bals  Bartonella alsatica Pathway bals01100   Metabolic pathways bals01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bals00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HWV54_06135    00074 Mycolic acid biosynthesis     HWV54_06135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HWV54_06135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QLC52424 LinkDB All DBs Position 1497328..1497564 Genome browser AA seq 78 aa AA seqDB search MSDTVERVKKIIVEHLGVNADKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDEAA ETIFTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagtagagcgcgttaaaaaaattatcgtggagcatcttggtgttaatgca gataaggttgtagaaaatgcaagctttatcgatgatctaggagcagatagccttgatacg gttgagcttgttatggcttttgaagaagaatttggtatagaaattccagatgaagctgct gaaacaatttttacagttggtgatgcagtaaagtttatcgataaagcttctgcctaa

DBGET integrated database retrieval system