Burkholderia ambifaria AMMD: Bamb_2811 Help Entry Bamb_2811         CDS       T00398                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bam  Burkholderia ambifaria AMMD Pathway bam00998   Biosynthesis of various antibiotics bam01100   Metabolic pathways bam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bamb_2811    00074 Mycolic acid biosynthesis     Bamb_2811   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bamb_2811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABI88367 UniProt:  Q0BBV6 LinkDB All DBs Position 1:complement(3101169..3101453) Genome browser AA seq 94 aa AA seqDB search MGRLPASMMNALEQELATLIIGELNLEDVPLETVTAGTPLYGEGFGLDSIDILEIALLIS KKYGFELRSDNPDNKQIFATLGALAAYVAAHRTK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgggccgcctgcccgcaagcatgatgaacgcactggaacaagagctcgccacgctgatc atcggcgaactgaatctcgaagacgtcccgctcgaaacggtgacggccgggaccccgctg tatggcgagggcttcgggctcgactccatcgacatcctcgaaatcgcgctgctgatctcg aagaaatacggcttcgagctgcgctcggacaatccggacaacaaacagatcttcgcgacg ctcggcgcgcttgccgcatacgtcgccgcgcatcgcacgaagtga

DBGET integrated database retrieval system