Burkholderia ambifaria AMMD: Bamb_3599 Help Entry Bamb_3599         CDS       T00398                                  Name (GenBank) putative acyl-carrier-protein   KO K02078   acyl carrier protein Organism bam  Burkholderia ambifaria AMMD Pathway bam00998   Biosynthesis of various antibiotics bam01100   Metabolic pathways bam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Bamb_3599    00074 Mycolic acid biosynthesis     Bamb_3599   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Bamb_3599 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABI89153 UniProt:  Q0B9M0 LinkDB All DBs Position 2:432352..432657 Genome browser AA seq 101 aa AA seqDB search MDTLKLQIKQLLIEMLDLSDMTVDDIDDDAPLFSTDGIGLDSVDALEVGIMLRKKFQLTI AANDERTKAHFRSINTLAAFIAEQQSHQASQEAVLEKGSHS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggatactttaaaactgcaaattaagcagcttctgatcgagatgctcgatctcagcgac atgacggtggacgatatcgatgacgatgcgccgctgttctcgaccgacggaatcggcctc gattccgtcgatgcgctcgaagtcggcatcatgctgcgcaagaagtttcaattgacgatc gccgcgaacgacgagcgtacgaaagcgcattttcggtcgatcaacacactggcggcattc attgccgagcagcagtcgcatcaggcatcgcaagaagccgtgctggaaaaggggagtcac tcgtga

DBGET integrated database retrieval system