KEGG   Bacillus velezensis UCMB5033: RBAU_1090
Entry
RBAU_1090         CDS       T02795                                 
Symbol
med
Name
(GenBank) positive regulator of comK
  KO
K05519  transcriptional activator of comK gene
Organism
bama  Bacillus velezensis UCMB5033
Brite
KEGG Orthology (KO) [BR:bama00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bama03000]
    RBAU_1090 (med)
Transcription factors [BR:bama03000]
 Prokaryotic type
  Other transcription factors
   Others
    RBAU_1090 (med)
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: CDG29058
UniProt: S6G1G1
LinkDB
Position
1136386..1137339
AA seq 317 aa
MITRLVMIFSVLLLLSGCAQTPFKGKIEKVGMLFPDTISDLVWGTKGYKGLLAIQSEFNV
DVYYKENIRSDEDILKAIDDFHKKGVNLLYGHGNEYEEIFNMISKDYPDMEFVVANGTAK
SDNVTSVHLMGEAMGFFGGMTAAHMSKTNEVGVIASFLWQPEVDGFIKGAKYEKPDITVN
TEFTDHWDNGNEALHLYEKLKAEGTDVVYPAGDGYNVPVIQQIKKDGLYAIGYVAEQSNL
GKNTVLTSTVQNVDKAYTLIAEQYNKGTLKSGDHNFDFREGVVEMGTFSPLVDKAFQDKI
SDLVKTYNRTNELPSNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcaccaggcttgtcatgatcttttctgtcctccttttattgagcggatgcgcacaa
actccgtttaaaggaaaaattgagaaggtcggaatgctttttcccgatactatcagtgac
ttggtatggggcacaaaaggttacaaaggtttattagcgatacaatctgaatttaacgtt
gacgtttattataaagaaaatatcagatccgatgaagatattttaaaagcgatagatgat
tttcataaaaaaggagtcaatcttttatacgggcacggaaatgaatacgaggaaatcttc
aatatgatcagcaaggattatcccgacatggaattcgtcgtcgcaaacggaacggcgaaa
agcgataatgtcacaagcgttcatcttatgggagaagcaatgggttttttcgggggaatg
acagccgcccatatgtcaaaaaccaatgaggtcggcgtcatcgcctcctttttgtggcag
cctgaagtagacggctttatcaaaggggcgaaatatgaaaagcctgatatcaccgtcaat
actgaatttacggaccactgggataacggcaatgaagcgctgcatctttacgagaagtta
aaagcggaaggcacggatgttgtatatccggccggagacgggtataatgttcctgtcatt
cagcaaatcaaaaaagacgggctttacgccatcggctatgtcgccgagcaatcgaatctc
ggcaaaaacacggtgctgacaagcacggtgcaaaacgtagataaagcctatacattaatt
gccgagcaatataataaaggtacgctcaagagcggagatcacaactttgatttcagggaa
ggagtcgttgaaatggggacgttcagccctctggtggacaaagcatttcaagacaaaatc
tcagaccttgtaaaaacgtataaccgaacaaatgaactgccgtcaaatgaatag

DBGET integrated database retrieval system