Bacillus velezensis UCMB5033: RBAU_1528 Help Entry RBAU_1528         CDS       T02795                                  Symbol rpoZ Name (GenBank) Omega subunit of RNA polymerase   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism bama  Bacillus velezensis UCMB5033 Pathway bama03020   RNA polymerase Brite KEGG Orthology (KO) [BR:bama00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     RBAU_1528 (rpoZ)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bama03021]     RBAU_1528 (rpoZ)    03400 DNA repair and recombination proteins [BR:bama03400]     RBAU_1528 (rpoZ) Enzymes [BR:bama01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      RBAU_1528 (rpoZ) Transcription machinery [BR:bama03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      RBAU_1528 (rpoZ) DNA repair and recombination proteins [BR:bama03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       RBAU_1528 (rpoZ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  CDG29496 LinkDB All DBs Position 1597080..1597283 Genome browser AA seq 67 aa AA seqDB search MLDPSIDSLMNKLDSKYTLVTVSARRAREMQIKKDQQIEHTISHKYVGKALEEIDAGLLS FEREDSE NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgttagatccgtcaattgactctttaatgaataaattagattctaaatatacgctggtg accgtgtctgcaagacgcgcgcgtgaaatgcagatcaaaaaagaccagcagattgaacat accatttctcacaaatatgtaggcaaagctttagaagaaattgacgcgggcctgctttcg tttgaaagagaagacagcgaataa

DBGET integrated database retrieval system