Bacillus velezensis UCMB5033: RBAU_2343 Help Entry RBAU_2343         CDS       T02795                                  Symbol dfnX Name (GenBank) DfnX   KO K02078   acyl carrier protein Organism bama  Bacillus velezensis UCMB5033 Pathway bama00998   Biosynthesis of various antibiotics bama01100   Metabolic pathways bama01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bama00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RBAU_2343 (dfnX)    00074 Mycolic acid biosynthesis     RBAU_2343 (dfnX)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RBAU_2343 (dfnX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1280 Motif Other DBs NCBI-ProteinID:  CDG30311 LinkDB All DBs Position complement(2502257..2502529) Genome browser AA seq 90 aa AA seqDB search MEQTKEMKQIIAQIIQDIQEQQSYRAVEAGDDVRVIEDLGFSSLDIAQLVAQMEMETGVD PFSQGETISSITTVGSICDIYQKYMDSAQS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggaacaaaccaaggaaatgaagcagatcatcgcacaaatcattcaggacattcaagaa cagcagtcatatcgggccgtcgaagcgggggatgatgtgagagtcatagaggatctgggc ttctcatcactggatatcgctcaattagtcgcacagatggagatggaaaccggagtagat cctttttcccaaggagaaacgatttccagcattacaaccgtcggcagcatttgtgatatt tatcaaaaatatatggacagtgctcaatcatga

DBGET integrated database retrieval system