Bacillus velezensis NAU-B3: BAPNAU_3609 Help Entry BAPNAU_3609       CDS       T02859                                  Symbol ywlF Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism bamb  Bacillus velezensis NAU-B3 Pathway bamb00030   Pentose phosphate pathway bamb00051   Fructose and mannose metabolism bamb00710   Carbon fixation by Calvin cycle bamb01100   Metabolic pathways bamb01110   Biosynthesis of secondary metabolites bamb01120   Microbial metabolism in diverse environments bamb01200   Carbon metabolism bamb01230   Biosynthesis of amino acids Module bamb_M00004   Pentose phosphate pathway (Pentose phosphate cycle) bamb_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:bamb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BAPNAU_3609 (ywlF)    00051 Fructose and mannose metabolism     BAPNAU_3609 (ywlF)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     BAPNAU_3609 (ywlF) Enzymes [BR:bamb01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      BAPNAU_3609 (ywlF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Metallophos_2 Motif Other DBs NCBI-ProteinID:  CDH97389 LinkDB All DBs Position complement(3793973..3794422) Genome browser AA seq 149 aa AA seqDB search MKVAIASDHGGVHIREEIKSLLDELQIEYIDMGCECGDGSVDYSDYAFPVAEKVVNGEAD RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREI AKVWLTTEFTGGRHERRIGKIADYEEKNL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagctattgcgtcagatcacggcggcgtccatatccgcgaagaaataaaaagt cttttggatgaattgcagattgaatacattgatatgggctgtgaatgcggcgacggctct gtcgattattcagactacgcttttccggtagcggaaaaagtggtgaacggcgaagctgac aggggaattttaatttgcggcacaggcatcggcatgagcatctccgcaaataaggtaaag ggcatacgctgtgcgcttgcccatgacaccttcagcgcaaaagcgacgcgtgaacacaat gacacgaatgttcttgcgatgggcgaacgcgtcatcggcccggggctggcgcgcgaaatc gcaaaagtctggctgacgactgaatttacgggcggccgccacgaacggcggatcggcaaa atcgcagattacgaagaaaaaaatctgtaa

DBGET integrated database retrieval system