KEGG   Bacillus amyloliquefaciens CC178: U471_18790
Entry
U471_18790        CDS       T02893                                 
Name
(GenBank) bioI
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bamc  Bacillus amyloliquefaciens CC178
Pathway
bamc00780  Biotin metabolism
bamc01100  Metabolic pathways
bamc01240  Biosynthesis of cofactors
Module
bamc_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bamc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U471_18790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bamc00199]
    U471_18790
Enzymes [BR:bamc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     U471_18790
Cytochrome P450 [BR:bamc00199]
 Cytochrome P450, bacteria type
  CYP107 family
   U471_18790
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AGZ56581
LinkDB
Position
complement(1908288..1909484)
AA seq 398 aa
MTADLSIAHPSLHADSGFWNDPYPFYDKLRSIDPVYKGTVLKYPGWYVTGYKEAAAILKD
IRFKNRIPLPEASTKYQNLSHIQHDMLLFKNQSDHKRMRMLIGKEFTAKTAESLRPCIKE
TVHDLLDQVQIKKTADLVSEFAFPLASLIIAEILGVPKEERYQFRQWTADVIQAIDLTRS
RKTLVRASDTAGRLTSYFRDLIHKREAHPQQDLISRFIMEEQLSKEEVLATCILLVIAGH
ETTVNLISNGVFTLLKHPEQLSALRENPSLIETAVEECLRYDSPAQLTARTASEDCEING
KTIKKGEQVYILLGAANRDPSIFDQPHKMDIQRKPNPHLAFGRNAHFCIGSSLARIEAQI
AILTLFERMPKLRLAAHRLEYRKLIGFRSLKELPVVIG
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgacggcggacctatcgattgcacatccgtctctccatgcggattcgggtttttggaat
gacccttacccgttttatgacaaactgcgatccattgatcctgtttataaaggaaccgta
ttaaaatatccgggctggtatgtcaccgggtacaaagaagcggcagcgattctgaaagac
attcggtttaaaaaccgcattcctcttccggaagcttcaacgaaatatcaaaatctatcg
catatccagcacgatatgctgttatttaaaaatcaatcagaccataagcggatgcggatg
cttatcggtaaagaatttaccgcaaagacggcggaatcacttcgcccttgtataaaagaa
acggttcatgacttgttggatcaagtccaaatcaaaaaaaccgcggaccttgtttcagag
tttgcctttccattggcaagccttatcattgcggagatactcggagtgccgaaagaggag
agatatcaattcagacaatggacggcagacgtcattcaggccattgatcttacccgatca
agaaagacgttagtcagagcaagcgacaccgcaggcaggctgacgtcatatttcagagat
ttgattcacaagcgggaagcgcaccctcagcaagacttgatcagcaggtttattatggag
gaacagctttcaaaagaggaagtgctcgcgacatgtatcttacttgtcatagccggacac
gagacgacggtaaacctcataagcaacggtgtgtttactttattgaaacaccctgaacag
cttagcgcactgagagaaaacccctcgcttattgaaactgcagttgaggaatgtctgcgc
tacgacagccccgcgcagctgacggcacgcaccgcctcagaagactgcgaaataaatggg
aagaccataaaaaaaggagagcaggtatatatccttttaggggcagccaatcgcgatcca
agcatattcgatcaacctcacaaaatggatatccaaagaaaaccgaatccgcatcttgca
ttcggaaggaacgcccatttttgcataggctcctcattagcgcgcatcgaagcacaaatt
gcaattctcacactgtttgagcggatgcctaagcttcggctggctgcacaccgccttgaa
taccgcaagctcattggttttaggtcgctcaaagagctcccggttgtcattggctga

DBGET integrated database retrieval system