Bacillus amyloliquefaciens LFB112: U722_07000
Help
Entry
U722_07000 CDS
T02965
Name
(GenBank) hypothetical protein
Organism
bamf
Bacillus amyloliquefaciens LFB112
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SplA
Motif
Other DBs
NCBI-ProteinID:
AHC41856
LinkDB
All DBs
Position
1322349..1322486
Genome browser
AA seq
45 aa
AA seq
DB search
MKKREEQYINEAEYVPHPTKEGEYALMLHESYHFLSEEDESDLPE
NT seq
138 nt
NT seq
+upstream
nt +downstream
nt
atgaagaaaagggaagagcagtatatcaacgaggctgagtatgtaccgcacccgacaaaa
gaaggggaatacgcgctcatgttgcatgaatcctatcatttcctttcagaagaggatgaa
agcgatttgccggaataa
DBGET
integrated database retrieval system