Bacillus velezensis UCMB5036: BAM5036_2130 Help Entry BAM5036_2130      CDS       T02480                                  Symbol dfnX Name (GenBank) DfnX   KO K02078   acyl carrier protein Organism baml  Bacillus velezensis UCMB5036 Pathway baml00998   Biosynthesis of various antibiotics baml01100   Metabolic pathways baml01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:baml00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BAM5036_2130 (dfnX)    00074 Mycolic acid biosynthesis     BAM5036_2130 (dfnX)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BAM5036_2130 (dfnX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1280 Motif Other DBs NCBI-ProteinID:  CCP22169 LinkDB All DBs Position complement(2335081..2335353) Genome browser AA seq 90 aa AA seqDB search MEQTKEMKQIIAQIIQDIQEQQSYRAVEAGDDVRVIEDLGFSSLDIAQLVAQMEMETGVD PFSQGETISSITTVGSICDIYQKYMDSAQS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggaacaaaccaaggaaatgaagcagatcatcgctcaaatcattcaggatattcaagaa cagcagtcatatcgggccgtcgaagcgggagatgatgtgagagtcatagaggatctgggc ttctcatcactggatatcgctcaattagtcgcacagatggagatggaaaccggagtagat cctttttcccaaggagaaacaatttcaagcattacaaccgtcggcagcatttgtgatatt tatcaaaaatatatggacagtgctcaatcatga

DBGET integrated database retrieval system