Bacillus velezensis UCMB5113: BASU_3320 Help Entry BASU_3320         CDS       T02796                                  Symbol ywlF Name (GenBank) ribose 5-phosphate epimerase   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism bamn  Bacillus velezensis UCMB5113 Pathway bamn00030   Pentose phosphate pathway bamn00051   Fructose and mannose metabolism bamn00710   Carbon fixation by Calvin cycle bamn01100   Metabolic pathways bamn01110   Biosynthesis of secondary metabolites bamn01120   Microbial metabolism in diverse environments bamn01200   Carbon metabolism bamn01230   Biosynthesis of amino acids Module bamn_M00004   Pentose phosphate pathway (Pentose phosphate cycle) bamn_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:bamn00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BASU_3320 (ywlF)    00051 Fructose and mannose metabolism     BASU_3320 (ywlF)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     BASU_3320 (ywlF) Enzymes [BR:bamn01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      BASU_3320 (ywlF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  CDG27599 LinkDB All DBs Position complement(3505078..3505527) Genome browser AA seq 149 aa AA seqDB search MKVAIASDHGGIHIREEIKSLLDELQIEYIDMGCECGAGSVDYSDYAFPVAEKVVNGEAD RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREI AKVWLTTEFTGGRHERRIGKIADYEEKNL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagctattgcgtcagatcacggcggcatccatatccgcgaagaaataaaaagt cttttggatgaattgcagattgaatacattgatatgggctgtgaatgcggcgccggctct gtcgattattcagactacgcttttccggtagcggaaaaagtggtgaacggcgaagctgac aggggaattttaatttgcggcacaggcatcggcatgagcatctccgcaaataaggtaaag ggcatacgctgtgcgcttgcccatgacaccttcagcgcaaaagcgacgcgtgaacacaat gacacgaatgttcttgcgatgggcgaacgcgtcatcggcccggggctggcgcgcgaaatc gcaaaagtctggctgacgactgaatttacgggcggccgccacgaacggcggatcggcaaa atcgcagattacgaagaaaaaaatctgtaa

DBGET integrated database retrieval system