KEGG   Bacillus velezensis AS43.3: B938_17925
Entry
B938_17925        CDS       T02382                                 

Gene name
bacA
Definition
(GenBank) BacA
  KO
K19546  prephenate decarboxylase [EC:4.1.1.100]
Organism
bamp  Bacillus velezensis AS43.3
Pathway
bamp00998  Biosynthesis of various secondary metabolites - part 2
bamp01100  Metabolic pathways
bamp01110  Biosynthesis of secondary metabolites
Module
bamp_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bamp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    B938_17925 (bacA)
Enzymes [BR:bamp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.100  prephenate decarboxylase
     B938_17925 (bacA)
SSDB
Motif
Pfam: PDT
Other DBs
NCBI-ProteinID: AFZ92587
LinkDB
Position
complement(3634316..3634930)
AA seq 204 aa
MIILDNSIQTKSKAYSISKLITINTLGPEGTSSEYAAKNFITNFTLLQGVNSKLSLHDTF
ESCIEKTLQSPLEYTIVPHAYDGIKHFYMRPDLQLLQIFRCDTPMYGLAVRPGFEYTDDM
LDKTVIVSHPSPINLIKYFTRKDVMFDLVNSTSAAAKRVKDGLSDIALTNELARQKYGLH
FVKTFKSIPMSWSLFGKGEIHDEN
NT seq 615 nt   +upstreamnt  +downstreamnt
atgattatattggataatagcattcaaacaaaaagcaaggcttattcaatatctaaactg
attacgatcaacacgctcggtcctgaagggacaagcagtgagtacgcagcaaaaaacttc
atcaccaatttcacccttctccaaggggtgaacagcaaattatcactgcatgatacattt
gaatcgtgcattgaaaaaacgcttcaaagtccgctggaatacacaattgtgcctcacgcg
tatgacggcattaagcacttctacatgagaccggatctgcagcttctgcaaattttcagg
tgcgacaccccgatgtacggcctggctgtccggcccggttttgaatatacggatgacatg
cttgataagactgtcatcgtatcccacccgtctcctatcaatttgattaagtattttacc
cgtaaagatgtcatgtttgatctggtgaactcaacgagcgcagccgcgaaaagagtgaag
gacggtttgtccgacatcgcgctgacaaatgagctggccagacaaaagtacggccttcac
tttgtcaaaacatttaaaagcattcccatgagctggtcattattcggaaaaggagagatt
catgatgaaaactga

DBGET integrated database retrieval system