KEGG   Bacillus velezensis TrigoCor1448: AJ82_10465
Entry
AJ82_10465        CDS       T03161                                 
Name
(GenBank) peptide synthetase
  KO
K15666  plipastatin/fengycin lipopeptide synthetase C
Organism
bamt  Bacillus velezensis TrigoCor1448
Pathway
bamt01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:bamt00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    AJ82_10465
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bamt01008]
    AJ82_10465
Polyketide biosynthesis proteins [BR:bamt01008]
 Nonribosomal peptide synthetase (NRPS)
  Linear NRPS
   Fengycin family lipopeptide synthetase
    AJ82_10465
SSDB
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AHK49390
LinkDB
Position
complement(1987455..1995104)
AA seq 2549 aa
MGQQPEIQDIYPLSFMQEGMLFHSLLDHDSRAYFEQAVFTINGQLDRERFQKSIDAVFER
YDIFRTTFIHKNVAKPRQVVLKNRPSRVQFHDISHLDEKAQDKYADRFRKEDKDKGFDLQ
SDPLMRVSILKKASERYVCIWSHHHIVMDGWCFGIVMKEFLMIYQSLGDGRLPSLEPVQP
YGKYIKWLMKQDRKEAEIFWKTRLADLEQSASLPKKSAEPNGELEQAVFTISEEQTNELK
NIAARAGATLNTVFQALWGLLLQRVSRCDDAVFGSVVSGRPSDLAGVEKMVGLFINTIPV
RVKSGSFSFLELVRHLQQETLQAEAYSYYPLYDIQAQSPLKQALFDHIIVFENVPAQREI
ENVSQAGSFDFAVEDFTMEEVTNYGCSIKVIPGNSLYIRLNFDTGIYDRVFMKNIETFLR
HMMKSVISDPEMSASEIALLDACEARNMLDAFNRTETVEPPAPTLHGLFTRRAALSPHRP
ALRFPGGMLTYAELDQYTDRLAVRLRQKGVRKESMVGVLAERSPEMVVSVLAVLKAGGAY
VPLDPEYPEDRLRYMLDDCGACLLLAQPGLSVPGFSGETLEASLSSLTGEAETGAVSDEA
DADSLAYIIYTSGSTGTPKGVAVEHRQAAAFLSGMQGQFPLTEEDIIVLKSSFSFDASIW
QLFWWTMSGASVYLLPAGWEKDPVRMIEAFASEKVTTAHFIPAMVNSFLDALETEPEETR
TRLGRTLTRVFAGGEALSPLTAARFADLLPETMLIHGYGPTEATVDAAFYVCDRKRDSGR
TRLPIGKPVPGARLYVLDSGGTIQPAGVAGELYIAGTGVARGYLNRPELTEERFLNDPFY
PGERMYQTGDIARWTEDGLVEWLGRSDGQVKVRGYRIEPGEIEAAIRRIDGIREAAVTAR
NEHGETALYAYIEGRESDDVRAELATRLPAYMMPAQFIEMSEWPVTPSGKLDRRALPAPG
GAADRQAYTAPRNVTEMKLCALWEEVLKNGPVGIRDHFFERGGHSLKATALVSRIAKEFG
VQVPLQDIFARPTVEELASVIQDLEESPYEAIQPAQTQDTYPVFSAQKRMYVLQQLEDGG
VGYNMPAVLELTGPLDRGRLEETFRQLVERHESLRTSFETGPDGEPVQRIHDSVPFQLDE
AESADAFVRPFCLEEAPLFRAALVKESDERHLLLTDMHHIISDGVSVNTLIKEFGELYAG
RSLAPMRLQYKDYSVWQRSFQEKEGYQKQEAYWLKRLEGELPVLELPADKARPAVRSFAG
GSVSCALDAETASGLHRIARDHGSTLYMVLLAAYNTLLARLSGQEDIIVGSPIAGRPHKD
LEPILGMFVNTLAIRTEPKGDKRFTDYLAEVRQAALEAYEHQDYPFEELVERLGVQRDTS
RNPLFDVMFVLQNMERESLVLNKLHLAQAADTSHKTAKFDATLYASEGSDGSISFDFEFN
TDIYQKQTIEKWLCYFTRILTKVIENQAIPLGDIHVLDNAETNRVIYQFNQTKSDYPRHE
TISRLFERQAKETPDARAVVYDGQILTYRELNERANRIAAALRSNGVGPESVVALLTGRT
TELASGILGILKAGGAYLPIGDDVPRERAEWMLKDCKADILLQSDKLDGLPLSGKRLFIE
DIQTKAGLSSENPEPLGGPESLAYMIYTSGSTGAPKGVMIEQRSVIRLVKNSNYIDFTPE
DRLLFTSSLGFDVTTFEIFGPLLNGASLYVSDQETYLDSDVLETFIQQNGITTLWLTSSL
FNHLSEQNEHVFSGLSRLIIGGEALSPSHVNRVRNALPHLSVWNGYGPTENTTFSTCFLI
EQSYDHSIPIGRPVGNSTAYIINSRGTPQPIGVIGELCTGGDGVARGYFGRPELTEEKFV
PNPFVPGERMYRTGDLARWLPDGTIEYAGRMDDQVKIRGYRVELGEIEAALRSLDGVKEA
AVSVRTGQSGNKELIAYMSLQTDMDTEKVRSSLSKQLPNYMVPAYMMELEKLPLTPNGKL
DRKNLPEPELALQTAYTAPRNELEEQLSVIWQEVLGAKQVGIEDSFFELGGDSIKALQVS
SRLGRYGWKMTASDLFRHPSIKELAPLIRKAERVIDQRPVEGNIPWTPVQHWFLSQRMEN
RNHFNQSVMMFSSDALHKQPLKEALEHLVIHHDALRITVSAENESFRQTNHGIQKDELYS
LDIWDLSETDTWEKEIESEVAALQQRMDIEKGPLLKAGWFKTRSGDYLFITVHHLAVDGV
SWRILLEDLSAAYTQAVKGQPVQLPPKTDSFKQYAERLSEYAKSSKLMREEEYWRFIEEE
TAAELPHEKPQHQTGADSIRQTVSFTLTEEETSVLLQQVNRAYHTDTQDILLTAAALALR
DWTGGGRLRIAMEGHGREHIMPELDISRTVGWFTSMYPVLIDLNTAGAELGTAVKTVKDT
LGRIPDKGIGYGILKYMTPPEQKTIRFRQAPEISFNYLGQFNDTEDQHTFSLSGLASGHD
ITPTWQREQAVEMSAMAAQNKLHFSLSYPPSRFRKETMEQLLQTLQQYLRDIMAHCTGKE
EAEKTVSDFSSKTLTSDDLDSIASFVEEL
NT seq 7650 nt   +upstreamnt  +downstreamnt
atggggcagcaaccggaaatacaagatatatatcctttatcttttatgcaggagggcatg
ctttttcattctctgttggatcatgactcaagagcctacttcgaacaagcggtgtttacg
atcaacggacagcttgaccgggaacgattccaaaaaagtatagatgctgtttttgaacga
tacgatattttccgtacgacatttattcataagaatgtggcgaagccccgccaagtcgtg
ttgaaaaacaggccgagccgcgttcagtttcatgatatttctcatttggacgagaaggcg
caagacaaatatgccgaccggttcagaaaagaagataaagataaaggctttgatttgcag
tcagaccctctcatgagagtctccattttgaaaaaagcgtccgaacgctatgtttgtata
tggagccatcatcatatcgtcatggacggctggtgcttcgggattgtcatgaaggaattt
ctgatgatctatcaatctctcggagacgggcggctcccgtctctcgagcctgttcagcca
tatggtaagtatattaaatggctcatgaagcaggatcgtaaagaagccgagattttttgg
aaaacgagacttgccgatcttgagcaatcggcgtctcttccgaaaaaatccgcggaacca
aatggcgaacttgagcaggcggttttcaccatttctgaagagcagacaaatgagctgaag
aacattgcggcaagggcgggagcaacgctgaatacagtgttccaggcactgtggggcctg
ttgctgcagcgtgtcagccgctgtgatgacgccgttttcggttctgtcgtttccggccgg
ccgtcggatctcgcaggcgtggaaaaaatggtgggcctgtttattaatacgattcccgtg
cgggtgaaaagcggttcattttcttttctggagctcgtcaggcatttgcagcaggagacg
ctgcaagcagaagcgtacagctattatccgctgtatgacattcaggcgcaaagccctttg
aagcaagcgctgtttgaccacattatcgtgtttgaaaatgtgccggcccagcgtgaaatt
gaaaatgtgagtcaggcaggttcatttgattttgcggtagaagatttcacgatggaggaa
gtcacaaactacggatgcagcataaaggtgattccgggaaattctctttatatccgctta
aactttgataccggtatatacgatcgtgtttttatgaagaatattgaaacatttttacgg
catatgatgaagtcagtcatttccgaccctgaaatgagcgcctccgagatcgcattgctt
gatgcgtgtgaagccagaaatatgctggatgcgtttaaccgtacagaaacggttgaaccg
ccggctccgacgcttcacgggctgtttacccgccgtgccgcgctttcgccgcatcgtccg
gcgctccgttttccgggcggtatgctgacgtacgccgagcttgaccagtacacagacagg
ctcgccgttcggctccgacaaaaaggcgtccgcaaagaaagcatggtcggcgtgctcgct
gaacgctcgccggagatggtggtttctgtgcttgccgtgttaaaagcgggcggcgcctac
gtgccgcttgacccggagtatcctgaggacaggctgcgctatatgctcgatgactgcggc
gcttgtctcctgcttgcacagccgggattatccgttcccggtttttccggagaaacgcta
gaagcgtctctttcttctctgacaggcgaggcggagacaggggctgtctctgacgaagcg
gatgctgattcgctcgcttatatcatttatacgtccggttcgacgggaacaccgaaggga
gtggctgttgaacaccgtcaggccgccgcctttttatcagggatgcaagggcagttcccg
ttgacggaagaggatattatcgtgctgaaatcatccttttctttcgacgcttccatctgg
caattgttttggtggacgatgtcaggcgcctccgtgtatctgcttccggccggctgggag
aaagatcctgtgcggatgattgaagcgtttgcctcagaaaaggtgacgaccgcgcatttt
attccggcaatggtcaacagctttttagacgcgctggaaacggagcctgaggaaacaaga
acacgcctcggcagaacactgacacgcgtgtttgccggaggggaagctctttcaccgctt
acggctgcccggtttgcagatctgttgccggagacgatgcttattcacggctatggaccg
acagaagcgacggttgatgcggcgttttacgtctgtgaccgaaaacgggacagcggacgg
acaaggcttccgatcggaaaacccgttccgggtgcccgtctgtatgtattagatagcgga
ggaaccatccagcctgcgggcgtggcaggagagctgtacatcgcggggaccggggtggcc
cggggctatctgaaccggcctgagctgacggaggagcgttttctcaatgatccgttttac
ccgggagaacgcatgtatcagacgggtgatatcgcacgctggacagaagatggccttgtc
gaatggctcggacgttcagacggacaggtgaaagtccgcggctaccggattgaaccggga
gagatcgaagcggcgatccggcgcatcgacggcattcgtgaggcggcagtcaccgcccgg
aacgaacacggcgaaaccgcgctttacgcctatatcgaaggacgggaaagcgatgacgtg
cgggcggagcttgcgacacgccttccggcctacatgatgccggctcagtttatagagatg
agcgaatggccggtcacgccgagcggaaaacttgaccgccgcgcgctgccggctcccggc
ggagcggcagacagacaggcgtacaccgccccgcggaacgtcacggaaatgaagctttgc
gccctttgggaagaggtgctgaaaaacggccccgtcggcatccgggatcacttttttgag
cggggcggccattcgttaaaagcgacggctctcgtctcccgcatcgccaaagagttcggt
gttcaggtgccgttacaggacatcttcgcccggccgacggtggaagagctcgcttcggtt
attcaggacttggaagaaagcccgtatgaagcgattcagcctgcgcaaacacaggacacc
tatccggtgttttcggcgcagaaacggatgtatgtgctccaacagcttgaagacggcggt
gtcggctacaatatgccggctgtgctggaactgacgggcccgcttgaccgcggccggctg
gaggagacgttccggcagcttgtggagcggcatgagtcgctcagaacgtcctttgaaacg
gggcctgacggcgaaccggtgcagcgcatccatgacagcgtaccgtttcagctggatgag
gccgagtcagctgacgcattcgtccggccgttttgtctggaggaagcgccgctcttccgt
gcggctctcgtgaaagaatcagacgaacgccatctattattaacggatatgcatcatatt
atttctgacggtgtgtccgtcaacaccttgataaaagaattcggcgagctgtacgcaggc
cgttcgcttgcgccgatgcgccttcaatataaagactattccgtctggcagcggtcgttt
caggagaaagaagggtaccagaagcaggaagcctattggctgaagcggcttgaaggagag
cttccggtgcttgagcttccggctgacaaggcccgtccggctgtcagaagctttgcgggc
ggcagcgtatcgtgcgcgcttgacgctgaaacggcatccggccttcaccgcatcgcccgg
gatcacggctccactttgtatatggtgcttctcgccgcgtacaatacgttactcgcgagg
ttgagcgggcaggaagacatcatcgtcggctcgccgattgccgggcgtccgcacaaagac
cttgaaccgattctcggcatgttcgtcaacacgctggccatcagaacggagccgaaaggg
gacaaacggttcaccgattatttggcggaagtccgccaggccgcgcttgaggcctatgag
catcaggactacccgtttgaagagctagtggaacggcttggcgtgcagcgggacacgagc
cgcaatccgctgtttgacgttatgtttgtgctccaaaatatggagcgtgaatccctggtg
ttaaataagctgcatttggctcaagctgcggatacaagtcataaaaccgcaaagtttgat
gccacgctttacgcgtcagaagggtctgacggttccatcagctttgattttgaattcaat
acagatatctatcaaaaacagacaattgaaaaatggctttgttattttacccgtattctt
acaaaagtaattgaaaaccaagcgataccgcttggtgacattcacgtactggataatgct
gaaacaaatcgcgtcatttatcagtttaatcagacgaaaagcgattacccaagacacgaa
accatcagccgtttatttgagcggcaggcaaaagaaacccccgatgcccgggcagttgta
tatgatggacaaatcttgacataccgtgagctgaacgaacgggctaacagaatagcggcg
gctctccgatcaaatggcgtcggtccggaaagcgttgtcgccttattaaccggccgcaca
acagagcttgcctccggaatcctcggaatattaaaagcgggaggcgcctacttgcctatt
ggtgacgatgtgccgcgggaacgggctgaatggatgcttaaagactgtaaagctgatatt
cttctccaatctgataaacttgacggtctgccgctttcaggaaaacgtttattcatagag
gatattcaaacaaaggccggcttgagttcggaaaatcccgaaccgctcggcggacctgaa
tcgttggcctacatgatttatacgtccggatcaacaggtgcgccaaaaggcgtcatgatt
gaacagcgaagcgtgatccgccttgtgaaaaacagcaattatattgattttacgccggaa
gacagactattgtttacttcatcattaggatttgacgttacgacatttgaaatattcggt
ccgcttttaaacggcgcttctttatatgtaagtgaccaggaaacctatctcgactcggat
gttctggaaacatttatacagcaaaacggcattacgacactgtggctgacatcgtctctg
ttcaaccatttatcagaacaaaatgaacacgtgttttccggattatcccgattgattatc
ggcggggaagcactgtccccaagccatgtaaaccgggttcggaatgcgcttccgcatctc
tcagtatggaatggatacggaccgactgaaaacacgacgttctcgacttgctttttgatt
gaacaatcatacgatcattcaatcccgatcgggcgccctgtcggaaattcaaccgcatat
atcataaacagcaggggaacaccgcagccgatcggcgtcatcggcgaattgtgcacgggc
ggagacggtgtggcaagaggatatttcggccgccctgagctgacggaagaaaaatttgtc
cctaatccttttgttcccggagaacggatgtaccgcaccggagatttagcccgctggctg
ccggacggaacgatcgaatatgccgggcggatggatgatcaagtgaaaatccgcggttat
cgggtggagctgggagagattgaagccgcactgaggagcctggacggcgtgaaagaagct
gccgtgtcagtcagaaccgggcagtccggcaataaagaactgatcgcatatatgagtctg
cagacggacatggatacagaaaaagtgcgttcttcactgtctaagcaactgccgaattac
atggttccggcctatatgatggaacttgagaagctgccgcttacgccgaacggtaaattg
gatcggaaaaatctgcccgaaccggagctcgcgcttcaaaccgcatacacagctccccgc
aatgagctcgaagaacagctttccgtgatctggcaggaagtgctcggcgcaaaacaagtc
gggattgaggactcattttttgaattgggcggcgactcaatcaaagcgctgcaagtttcc
tcacggctcggacgctatgggtggaaaatgacggcgagtgacttattccggcatccgtcc
attaaggagctcgcgccacttatccggaaagcggaaagagtcatcgatcagcggccggtg
gaaggaaacattccttggacacccgttcagcactggtttttatcacagcggatggaaaac
agaaatcatttcaatcagtccgtcatgatgttcagctctgacgcattgcataaacagccg
ctcaaagaagccttggagcatcttgtcattcatcatgatgcactgcggatcaccgtcagt
gcagaaaacgaaagtttcagacaaaccaatcacggtattcaaaaagatgaactgtacagc
ttggacatttgggatctgtctgagacagatacttgggaaaaagaaatagaaagtgaagtc
gctgcgctccaacagcggatggatattgaaaaaggcccgttattaaaagccggctggttc
aaaacccggtccggggattatttattcatcaccgtacatcacctggcggttgacggagtg
tcatggcgtattttgctggaggatttatctgccgcttacactcaagccgtaaaaggtcag
ccggtccagcttccgccaaagaccgattcgtttaagcaatacgctgaaaggctttcagaa
tacgcaaaaagcagcaagctgatgcgtgaagaagaatattggcgttttattgaagaagaa
acagccgccgaacttcctcatgaaaaaccgcagcatcagacgggagccgacagcattcgg
caaacggtaagctttacgcttacagaagaagaaacgtccgttttgcttcagcaggtcaac
cgggcctaccataccgatacgcaagatattcttctgactgccgcagctttggctttacgg
gactggacagggggcggcagactgcgcatcgcgatggaagggcacgggagagagcacatc
atgccggagctcgacatcagccgcaccgtaggctggtttacctccatgtatccggtgctc
attgacttgaacacagcaggcgctgagcttggaacggcggtaaaaacggtcaaagacaca
ctcggaagaataccggataaaggaataggctacggcattttaaaatacatgacaccgcct
gaacaaaaaacaatccgcttcagacaagcgcctgaaatcagctttaactatttagggcaa
ttcaatgatacagaagatcagcacacattcagtctgtccggtcttgcaagcgggcacgac
atcacgccgacatggcagcgggaacaagcggtggaaatgagcgcgatggccgcacaaaac
aaacttcacttcagtttgagctatccgccgagccgcttccgcaaagaaacgatggaacag
ctgctgcaaactttacagcaatatttgcgtgatattatggcgcactgcacaggcaaagag
gaagcagaaaaaaccgttagtgattttagcagcaaaacgttaacatctgatgatttggac
agcatagcgagttttgtcgaggaactgtag

DBGET integrated database retrieval system