Candidatus Bipolaricaulis anaerobius: BARAN1_0403 Help Entry BARAN1_0403       CDS       T05525                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism bana  Candidatus Bipolaricaulis anaerobius Pathway bana01100   Metabolic pathways bana01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bana00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BARAN1_0403 (acpP)    00074 Mycolic acid biosynthesis     BARAN1_0403 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BARAN1_0403 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 SUKH_5 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  SQD92428 UniProt:  A0A2X3KUX6 LinkDB All DBs Position BARAN1:391825..392085 Genome browser AA seq 86 aa AA seqDB search MSEIADRVREIIAEQLMVDLDEITDEASFVNDLGADSLDTVELIMEFEDEFGIEIPDQYA ENIATVGEAIAYIEARVHEREGAGGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagtgagattgccgatcgggtacgggagatcatcgccgagcagctgatggtggacctc gatgagatcaccgatgaagcgtcgtttgtgaacgacctcggtgcggactccctcgatacg gtcgagctgatcatggagttcgaggacgagttcgggattgagatcccggaccagtacgcg gagaacatcgccacggtgggggaggcgatcgcctacatcgaggcccgcgtccacgaaagg gaaggggcgggcggggcgtag

DBGET integrated database retrieval system