Candidatus Bipolaricaulis anaerobius: BARAN1_0998 Help Entry BARAN1_0998       CDS       T05525                                  Symbol groS Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism bana  Candidatus Bipolaricaulis anaerobius Brite KEGG Orthology (KO) [BR:bana00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bana03110]     BARAN1_0998 (groS)    03029 Mitochondrial biogenesis [BR:bana03029]     BARAN1_0998 (groS) Chaperones and folding catalysts [BR:bana03110]  Heat shock proteins   HSP10    BARAN1_0998 (groS) Mitochondrial biogenesis [BR:bana03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     BARAN1_0998 (groS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  SQD93022 UniProt:  A0A2X3KKR7 LinkDB All DBs Position BARAN1:complement(1003022..1003294) Genome browser AA seq 90 aa AA seqDB search MKVKPLGNRILVKKIEEEERRTAGGIVLPESVKDEKAVKGEVVALGTGEKFEMKVGDTVL ISAYSGTEIRIGEEKHLLVKTTDVLAIVEG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtaaagcctttggggaatcggatcctcgtcaagaagatcgaggaggaagagcgc cgtacggcgggcgggatcgtccttcccgaatcggtgaaggatgagaaggcggtcaagggc gaagtggtcgccctcgggaccggcgagaagttcgagatgaaggtcggggacacggtactg atctccgcgtactccggcacggagatccgcatcggcgaggagaagcacttgctcgtcaag accacggacgtcctcgcgatcgtggaaggctag

DBGET integrated database retrieval system