Bartonella ancashensis: PU02_1160 Help Entry PU02_1160         CDS       T04086                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism banc  Bartonella ancashensis Pathway banc01100   Metabolic pathways banc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:banc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PU02_1160    00074 Mycolic acid biosynthesis     PU02_1160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PU02_1160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALE03974 UniProt:  A0A0M4M4B1 LinkDB All DBs Position complement(1265520..1265756) Genome browser AA seq 78 aa AA seqDB search MSDTEERVKKIIVEHLGVDADKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIFTVSDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagaagagcgtgttaagaagattatcgtggagcatcttggagttgacgca gacaaggtagtagagaatgcgagctttattgatgatcttggagcagatagccttgatacg gttgagcttgttatggcttttgaagaggaattcggtatagaaatcccagatgatgctgcc gagacgatttttacggttagtgatgcagtaaagtttattgataaagcttctgcgtag

DBGET integrated database retrieval system