Borreliella andersonii: QIA45_03535 Help Entry QIA45_03535       CDS       T09475                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism band  Borreliella andersonii Pathway band01100   Metabolic pathways band01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:band00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QIA45_03535 (acpP)    00074 Mycolic acid biosynthesis     QIA45_03535 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QIA45_03535 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  WNY66125 UniProt:  A0ABZ0CLH4 LinkDB All DBs Position 737379..737621 Genome browser AA seq 80 aa AA seqDB search MDNYEIFSKVRSIISEQLDKKEDEITLDSRFVEDLNADSLDIYELLYLLEEAFDDKIPEN EANEFETVGDVVDFIKKRKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggataattatgaaatttttagcaaggttaggtctattatatccgagcaacttgataaa aaagaagatgaaattactttagactctagatttgttgaggatcttaatgcagatagttta gatatttatgaacttttgtatttgcttgaagaggcctttgatgataagattccagagaac gaagccaatgaatttgaaacggtaggcgatgttgttgattttattaaaaagagaaaaggt tga

DBGET integrated database retrieval system