Burkholderia anthina: JFN94_00965 Help Entry JFN94_00965       CDS       T07672                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism bann  Burkholderia anthina Brite KEGG Orthology (KO) [BR:bann00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bann03036]     JFN94_00965    03400 DNA repair and recombination proteins [BR:bann03400]     JFN94_00965 Chromosome and associated proteins [BR:bann03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     JFN94_00965 DNA repair and recombination proteins [BR:bann03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       JFN94_00965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N MAGE YL1_C Motif Other DBs NCBI-ProteinID:  QQK04122 UniProt:  A0A6P2GK39 LinkDB All DBs Position 1:219666..219959 Genome browser AA seq 97 aa AA seqDB search MSSYKDLLAQREKLEKQIEEAKSREYAEVLNDVKQKIADYGFSLAELGLSRAKAGKVGRP RAGVAAKYRDPETGATWSGRGKPPRWIAGKDREQFSI NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgtcttcttacaaggacctgctggcccagcgggagaagctggagaagcaaatcgaagaa gcgaagtcgcgcgaatacgctgaagtgctgaatgacgtgaagcagaaaattgccgactac ggcttttcgctcgccgaactcggcctgagccgtgcgaaggcaggcaaggtcggtcgtccg cgcgcaggcgtggcggcaaaataccgcgatccggaaacgggcgcgacgtggtcgggccgt ggcaagccgccgcgctggatcgccggcaaggaccgcgaacaattttcgatttaa

DBGET integrated database retrieval system