Burkholderia anthina: JFN94_05445 Help Entry JFN94_05445       CDS       T07672                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bann  Burkholderia anthina Pathway bann00998   Biosynthesis of various antibiotics bann01100   Metabolic pathways bann01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bann00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JFN94_05445 (acpP)    00074 Mycolic acid biosynthesis     JFN94_05445 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JFN94_05445 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QQK03612 UniProt:  A0A104KMX2 LinkDB All DBs Position 1:1156195..1156434 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgtgtcaagaagatcgtcgctgaacaactgggcgtcgctgaa gccgagatcaagaacgaagcttcgttcgtgaacgacctgggcgcggactcgctcgacacg gtcgaactggtgatggctctggaagacgagttcggcatggaaatcccggacgaagaagca gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcaaacgtcaaggcgtaa

DBGET integrated database retrieval system