KEGG   Burkholderia anthina: JFN94_18825
Entry
JFN94_18825       CDS       T07672                                 
Name
(GenBank) enoyl-CoA hydratase
  KO
K07534  cyclohex-1-ene-1-carboxyl-CoA hydratase [EC:4.2.1.-]
Organism
bann  Burkholderia anthina
Pathway
bann00362  Benzoate degradation
bann01100  Metabolic pathways
bann01120  Microbial metabolism in diverse environments
bann01220  Degradation of aromatic compounds
Module
bann_M00540  Benzoate degradation, cyclohexanecarboxylic acid =>pimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:bann00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    JFN94_18825
Enzymes [BR:bann01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     JFN94_18825
SSDB
Motif
Pfam: ECH_1 ECH_2 DUF4351 Peptidase_S49
Other DBs
NCBI-ProteinID: QQK05933
UniProt: A0A7T6VL34
LinkDB
Position
2:585553..586329
AA seq 258 aa
MNEQPVLTETVGRVGIITLNRPRQMNALNDALMDALGDALLSFDGNDDIGAIVVTGNAQA
FAAGADIAAMADWDYMDVFRGDFITRNWETIRRVRKPVIASVAGVALGGGCELALACDIV
IAADDARFGLPEIKLALLPGAGGTQRLPRAVGKAKAMDMCLSGRLMSASEAERSGLVSRI
VAADVLRDESIALATTVAGYSSPALMAIKESINRAYESALSEGVLFERRQLHARFASQDA
REGIRAFLDKRKPAFGHR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaacgagcaaccggtcttgaccgaaaccgtgggacgggtcggcatcatcacgctgaac
cggccgaggcagatgaatgcgctgaacgatgcgctgatggatgcgcttggcgacgcattg
ctgtctttcgacggcaacgacgacatcggcgcaatcgtcgtgacaggtaacgcacaggct
ttcgcggcgggcgccgacattgccgcgatggcggactgggactacatggatgtgttccgc
ggcgacttcattacccgcaattgggaaaccattcgccgcgtgcgcaagccggtcatcgcg
tcggtggccggcgtggcgctcggtggcggctgcgagttggcgctggcatgcgacatcgtg
atcgcggccgacgatgcaaggttcggcttgccggaaatcaagctggcgctcctgccgggc
gcgggcggaacgcagcgcctgccgcgtgcggtcggcaaggccaaggcgatggacatgtgc
ctgagcggacgcctgatgagcgcatccgaagcggaacgcagcggcctcgtctcgcgcatc
gttgcggccgatgtgctgcgtgacgaaagcatcgcgcttgcgacgacagtcgccggttac
tcctcgccggcgttgatggcgatcaaggagtcgatcaatcgcgcatacgaaagcgcgctg
tcggaaggcgtgctgttcgaacgcaggcaattgcatgcgcgcttcgccagtcaggatgcc
cgggaagggatcagggcgtttctcgacaagcgcaaaccggccttcgggcaccgttga

DBGET integrated database retrieval system