Bacillus anthracis SVA11: BAPAT_1897 Help Entry BAPAT_1897        CDS       T03162                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bans  Bacillus anthracis SVA11 Pathway bans00975   Biosynthesis of various siderophores bans01100   Metabolic pathways bans01110   Biosynthesis of secondary metabolites Module bans_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:bans00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     BAPAT_1897  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bans01008]     BAPAT_1897 Polyketide biosynthesis proteins [BR:bans01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     BAPAT_1897 SSDB OrthologParalogGFIT Motif Pfam:  CFAP70_helical Motif Other DBs NCBI-ProteinID:  AHK38055 LinkDB All DBs Position 1856421..1856696 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPE DEVDPKAFLTVGSLLDFMEELQPLQDVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgctgtattaaaaattatgacagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgtttaaatcaagatttatatattgattca gtaatgatgttacaactcattgtatatatagaaatggatgtaaagctatgcgttccagag gatgaggtagacccaaaagcatttcttactgtaggatctttgcttgattttatggaggag ttgcagccgttacaggacgtaaatgtgaataactaa

DBGET integrated database retrieval system