Bacillus anthracis A16: A16_20210 Help Entry A16_20210         CDS       T02998                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism bant  Bacillus anthracis A16 Pathway bant00975   Biosynthesis of various siderophores bant01100   Metabolic pathways bant01110   Biosynthesis of secondary metabolites Module bant_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:bant00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     A16_20210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bant01008]     A16_20210 Polyketide biosynthesis proteins [BR:bant01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     A16_20210 SSDB OrthologParalogGFIT Motif Pfam:  CFAP70_helical Motif Other DBs NCBI-ProteinID:  AHE89282 LinkDB All DBs Position 1869845..1870120 Genome browser AA seq 91 aa AA seqDB search MRREALKNAVLKIMTEKMELKNVTHLEETMRLNQDLYIDSVMMLQLIVYIEMDVKLCVPE DEVDPKAFLTVGSLLDFMEELQPLQDVNVNN NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagacgggaagcgttaaagaatgctgtattaaaaattatgacagaaaaaatggaactg aaaaatgtaacgcatttagaagaaacgatgcgtttaaatcaagatttatatattgattca gtaatgatgttacaactcattgtatatatagaaatggatgtaaagctatgcgttccagag gatgaggtagacccaaaagcatttcttactgtaggatctttgcttgattttatggaggag ttgcagccgttacaggacgtaaatgtgaataactaa

DBGET integrated database retrieval system