Bacillus anthracis A16: A16_39950 Help Entry A16_39950         CDS       T02998                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bant  Bacillus anthracis A16 Pathway bant00998   Biosynthesis of various antibiotics bant01100   Metabolic pathways bant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bant00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A16_39950    00074 Mycolic acid biosynthesis     A16_39950   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A16_39950 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  AHE91256 LinkDB All DBs Position complement(3666880..3667113) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEETEVVPAASFKEDLGADSLDVVELVMQLEDEFEMEISDEDA EKIATVGDAVTYIESHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgttttagagcgtgtaacaaaaattatcgttgatcgtttaggagtagaagaa acagaagtagtaccagctgcgagcttcaaggaagatttaggagcagactccctagatgta gtagaacttgtaatgcaattagaagacgaattcgaaatggaaatttctgatgaagatgct gaaaagattgctactgttggcgatgctgtgacttacatagagagtcatctataa

DBGET integrated database retrieval system