Bacillus anthracis Vollum: DJ46_660 Help Entry DJ46_660          CDS       T03475                                  Name (GenBank) ACT domain protein   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism banv  Bacillus anthracis Vollum Pathway banv00290   Valine, leucine and isoleucine biosynthesis banv00650   Butanoate metabolism banv00660   C5-Branched dibasic acid metabolism banv00770   Pantothenate and CoA biosynthesis banv01100   Metabolic pathways banv01110   Biosynthesis of secondary metabolites banv01210   2-Oxocarboxylic acid metabolism banv01230   Biosynthesis of amino acids Module banv_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine banv_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:banv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     DJ46_660    00660 C5-Branched dibasic acid metabolism     DJ46_660   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     DJ46_660   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     DJ46_660 Enzymes [BR:banv01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      DJ46_660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_AHAS_ss ACT Motif Other DBs NCBI-ProteinID:  AIK65164 LinkDB All DBs Position 606440..606652 Genome browser AA seq 70 aa AA seqDB search MSHTFSLVIDNDPNVLLRISGIFARRGYYISSLNLNESEMELTAVCTEQEATLLVGQLKK LINVLQVNKL NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtcatactttttcattagttatcgataacgatccaaatgtcttattacgtataagt ggaatttttgctcggcgtggttattatatttcttcattaaatttaaatgaaagtgaaatg gagttaacggcagtttgtacagaacaagaagcaacattactcgttggtcagttgaaaaag ttaatcaatgtactacaagtaaacaaattataa

DBGET integrated database retrieval system