Bicyclus anynana (squinting bush brown): 112051160 Help Entry 112051160         CDS       T07476                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism bany  Bicyclus anynana (squinting bush brown) Pathway bany04814   Motor proteins Brite KEGG Orthology (KO) [BR:bany00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     112051160  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bany03037]     112051160    04812 Cytoskeleton proteins [BR:bany04812]     112051160 Cilium and associated proteins [BR:bany03037]  Motile cilia and associated proteins   Dynein arm    112051160 Cytoskeleton proteins [BR:bany04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      112051160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Bacteriocin_II Motif Other DBs NCBI-GeneID:  112051160 NCBI-ProteinID:  XP_023945438 UniProt:  A0A6J1NKH9 LinkDB All DBs Position 22:8794759..8797121 Genome browser AA seq 115 aa AA seqDB search MAQEEDEEDFTFNVEEVQNIVRDNIEFCLGGNIYSHSRTPQWISVITEKTLARLNKLNKP FKYIMRMTVTQKNGTGLHTAAAYFWDITTDGTCTVRWENKYMYCIVNIWALALQL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggcacaggaagaagacgaagaggatttcactttcaatgtagaagaagtacaaaacata gtaagggacaacattgagttttgtcttggagggaacatctatagtcattctcgtacaccc caatggatctctgtgatcacagaaaaaactttggcaagacttaataagctaaacaagcct ttcaaatacatcatgaggatgacggtgacccaaaaaaatggtacaggtttgcacacagct gctgcatacttctgggatataaccactgatggtacatgcacggtgcgatgggaaaacaaa tacatgtactgcatagttaatatatgggcactagcattacagctatag

DBGET integrated database retrieval system