Bicyclus anynana (squinting bush brown): 112051773 Help Entry 112051773         CDS       T07476                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism bany  Bicyclus anynana (squinting bush brown) Pathway bany04137   Mitophagy - animal bany04140   Autophagy - animal bany04142   Lysosome biogenesis bany04144   Endocytosis bany04145   Phagosome bany04148   Efferocytosis Brite KEGG Orthology (KO) [BR:bany00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     112051773    04145 Phagosome     112051773    04142 Lysosome biogenesis     112051773    04140 Autophagy - animal     112051773    04137 Mitophagy - animal     112051773    04148 Efferocytosis     112051773  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bany04131]     112051773   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bany04147]     112051773    04031 GTP-binding proteins [BR:bany04031]     112051773 Membrane trafficking [BR:bany04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     112051773 Exosome [BR:bany04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112051773   Exosomal proteins of other body fluids (saliva and urine)    112051773   Exosomal proteins of colorectal cancer cells    112051773   Exosomal proteins of bladder cancer cells    112051773 GTP-binding proteins [BR:bany04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     112051773 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 nSTAND3 cobW Septin AAA_16 PduV-EutP AAA_22 NACHT AAA_7 AAA_5 ATPase_2 AAA_24 G-alpha NTPase_1 SRPRB NB-ARC AAA_14 ABC_tran ATP-synt_ab RNA_helicase TniB PRK DAP3 Motif Other DBs NCBI-GeneID:  112051773 NCBI-ProteinID:  XP_023946323 UniProt:  A0A6J1NN36 LinkDB All DBs Position 4:complement(11435310..11438979) Genome browser AA seq 208 aa AA seqDB search MSSRKKVLLKVIILGDSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKEVIVDDRIVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKSLESWRDEFLIQASPRDPENFPF VILGNKVDLDNRAVSAKRAQQWCQSKNDIPYFETSAKEAVNVELAFQTIARNALAQETEA ELYNEFPDQIKLNANDNGRNRDGDNCAC NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaagaaaaaaggttcttctaaaagttattatcctcggcgatagtggcgtcggc aaaacatcattgatgaatcagtttgtcaacaagaaattttccaatcagtacaaggctaca ataggcgcagattttctcacgaaagaggtaatcgtcgacgacagaatcgtcacaatgcag atttgggacactgcgggacaggagcgattccagtcgcttggggtggcgttctaccgtggg gcggattgttgcgtcttagtttttgacgtaactgcccccaacacgtttaagtccttggag agttggagagacgaatttctgatacaggcatcaccgcgcgaccctgaaaacttcccattc gtcatactaggtaacaaggttgatttggataaccgtgcagtttctgccaaacgtgcacag caatggtgtcaaagtaaaaatgatattccgtacttcgaaacgagtgccaaagaagctgta aacgtagaactcgcattccagactatcgcgcgtaacgccctagctcaggaaactgaggca gagctttataatgagttcccagatcagatcaagttgaacgccaatgacaatggtcgcaac agggatggagacaactgtgcttgctag

DBGET integrated database retrieval system