Bicyclus anynana (squinting bush brown): 112053191 Help Entry 112053191         CDS       T07476                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism bany  Bicyclus anynana (squinting bush brown) Pathway bany04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:bany00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112053191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:bany04121]     112053191    03400 DNA repair and recombination proteins [BR:bany03400]     112053191 Ubiquitin system [BR:bany04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      112053191    Cul5 complex      112053191 DNA repair and recombination proteins [BR:bany03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      112053191 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  112053191 NCBI-ProteinID:  XP_023948286 UniProt:  A0A6J1NXV6 LinkDB All DBs Position 10:605335..613266 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVAPPSQMLFNKDSQLMEDEKTLAE YGLTSATAKAQCPAPIGLALRKENGEFEALELTPYSSPPDLPDVMKSQETNGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttctgatgattaggcgaaaaaaattaactatcttcacagacgccaaggat acaacgactgttctagaattgaagaaaatgatagaaggtatcttgaaggtggctccacca agtcagatgctgttcaacaaagacagtcagctgatggaggatgagaagacactggcagag tacggcctcacctcggccactgctaaagctcagtgcccggcacctattggactggctttg agaaaagagaatggtgaatttgaagccctggagttgactccatactcctcaccccccgac ctgccagatgtgatgaaatctcaggaaactaacggacaggaacagatggaccaacactaa

DBGET integrated database retrieval system