KEGG   Bicyclus anynana (squinting bush brown): 112053520
Entry
112053520         CDS       T07476                                 
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
bany  Bicyclus anynana (squinting bush brown)
Pathway
bany03083  Polycomb repressive complex
bany04120  Ubiquitin mediated proteolysis
bany04141  Protein processing in endoplasmic reticulum
bany04310  Wnt signaling pathway
bany04341  Hedgehog signaling pathway - fly
bany04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:bany00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112053520
   04120 Ubiquitin mediated proteolysis
    112053520
  09126 Chromosome
   03083 Polycomb repressive complex
    112053520
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112053520
   04341 Hedgehog signaling pathway - fly
    112053520
   04350 TGF-beta signaling pathway
    112053520
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bany04131]
    112053520
   04121 Ubiquitin system [BR:bany04121]
    112053520
   03036 Chromosome and associated proteins [BR:bany03036]
    112053520
Membrane trafficking [BR:bany04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    112053520
Ubiquitin system [BR:bany04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     112053520
   Cul7 complex
     112053520
Chromosome and associated proteins [BR:bany03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     112053520
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     112053520
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 112053520
NCBI-ProteinID: XP_023948727
UniProt: A0A6J1NU93
LinkDB
Position
6:complement(12052881..12054585)
AA seq 162 aa
MPNIKLQSSDNEIFDVDVEIAKCSVTIKTMLEDLGMDDDEEEVVPLPNVNSAILKKVIQW
ATFHKDDPPLPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTAAEEEQVRKENEWCEEK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgccgaacattaaattgcaatcgtccgataatgagatatttgacgttgacgtggaaatc
gccaaatgctcagttactataaaaaccatgttggaggacttgggaatggacgacgacgag
gaagaagtggttccattgccgaacgtgaattcagctatattaaagaaagttatccagtgg
gctactttccacaaagatgatccacctctaccggaagatgacgaaaacaaagagaagcgt
actgacgatatttcttcatgggatgcagatttcttgaaagtcgaccagggcacattgttc
gagttaattttggctgctaattatttagatattaaaggattgttggatgtcacgtgtaag
actgtagctaacatgataaaaggaaaaacacctgaggagattcgcaaaacattcaatatc
aaaaatgatttcacagcagctgaagaagagcaggtgcgcaaagaaaatgaatggtgtgaa
gaaaaataa

DBGET integrated database retrieval system