Bicyclus anynana (squinting bush brown): 112053760 Help Entry 112053760         CDS       T07476                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism bany  Bicyclus anynana (squinting bush brown) Pathway bany04013   MAPK signaling pathway - fly bany04145   Phagosome bany04148   Efferocytosis bany04310   Wnt signaling pathway bany04620   Toll-like receptor signaling pathway bany05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:bany00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     112053760    04310 Wnt signaling pathway     112053760  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     112053760    04148 Efferocytosis     112053760  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112053760  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     112053760  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bany04131]     112053760   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bany04147]     112053760    04031 GTP-binding proteins [BR:bany04031]     112053760 Membrane trafficking [BR:bany04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     112053760  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     112053760   Macropinocytosis    Ras GTPases     112053760  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     112053760 Exosome [BR:bany04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112053760   Exosomal proteins of other body fluids (saliva and urine)    112053760   Exosomal proteins of colorectal cancer cells    112053760   Exosomal proteins of bladder cancer cells    112053760 GTP-binding proteins [BR:bany04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     112053760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU CagD Motif Other DBs NCBI-GeneID:  112053760 NCBI-ProteinID:  XP_023949072 UniProt:  A0A6J1NV74 LinkDB All DBs Position 11:13662090..13721732 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPSTPIILVGTKLDLR EDKDTIEKLKDKKLTPIIYTSGLGMSKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV QPVKVKRKCSIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgatcaagtgtgtagttgtgggtgacggagctgtcggtaagacctgcctcctc atcagttacaccacaaacgccttccccggggagtacataccaacagtattcgacaactac tccgcgaacgtgatggtggacggtaagcccataaacctgggcctgtgggacacggctggc caggaggactacgaccggctgcggccgctctcctacccacagaccgacgtgttcctcata tgcttctcgctcgtcaaccccgcctccttcgagaacgtccgcgctaagtggtacccagaa gtgaggcatcactgcccgtcaacgcccatcatcctcgtgggcacgaagctcgatctccgc gaagacaaggacaccattgagaagctgaaggacaaaaagctaacgcccatcatttataca tcaggcctaggcatgtccaaggaaatcggcgcggtgaagtacctggagtgctcggcgctg acccagaaggggctgaagacggtattcgacgaggcgatccgcgccgtgctgtgccccgtg cagccggtcaaggtgaagcggaagtgttcgatactgtaa

DBGET integrated database retrieval system