KEGG   Bicyclus anynana (squinting bush brown): 112054734
Entry
112054734         CDS       T07476                                 
Name
(RefSeq) cytochrome P450 306a1-like isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
bany  Bicyclus anynana (squinting bush brown)
Pathway
bany00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:bany00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    112054734
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bany00199]
    112054734
Enzymes [BR:bany01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     112054734
Cytochrome P450 [BR:bany00199]
 Cytochrome P450, animal type
  CYP306 family
   112054734
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 112054734
NCBI-ProteinID: XP_023950387
UniProt: A0A6J1NYN4
LinkDB
Position
Unknown
AA seq 553 aa
MRFLCLRVDVFEDMDVIFVWIVTFVVGFWIFKKINQWKDLPPGPWGLPIVGYLPYLDRHH
PHLTLSALSKRYGPIYGLQMGSIYTVALSDHRLIREAFSKDVFSGRAPLYLTHGIMKGNG
LICAEGALWKDQRKLVTSWLKSFGMSKHGAIREKLAKRISSGVHELIQNVRDARGSPIPL
PNMISNSLGNVVNDIIFGFKFPLDDKTWKWFRQIQEEGCHEMGVAGVVNFLPFIRLISPS
TQKTMKVLVRGQAQTHRLYASIIAKRRKMLGLQVPPKAIHIEHENIFNDHPEGFIKCIKY
SKHASNTEVHYFDPKVLIPSNDECIMDSFLAEQKRRYENGEENAYFMRDEQMHYLLADMF
GAGLDTTAVTFSWVLLYMSLYTEVQEKVREEILSVYPEECEVDSAKLPYLTAVICETQRI
RSIVPVGIPHGCLQDTFLGNYRIPKGTMVVPLQWAVHMDPDVWEDPESFNPNRFIDDRGE
LLKPQEFIPFQTGKRMCPGDELSRMLTVGLITRLLRDFRIRLSSDPPTAEEMKGEVGIVL
TPPKVLYICEPIT
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgaggtttttatgtctaagagtagacgtgtttgaagatatggatgtcatattcgtatgg
attgtaacattcgttgtgggattttggatatttaaaaagatcaatcaatggaaggatcta
ccaccggggccatggggtctacccatcgtgggttacctgccttaccttgaccgacatcac
cctcatttgaccctctccgcactgtccaagcgctatggtcccatctatggcttgcaaatg
gggagtatatacactgtagcgttgtctgatcaccgcttaataagagaagccttctctaag
gatgtgttctcagggcgcgcgccgttatatttaacgcacggtattatgaagggcaatggg
ctcatttgtgccgagggagctttgtggaaggaccagcgtaagctagtgacgtcatggctc
aaaagcttcggtatgagcaaacatggcgccattcgcgagaagttggcgaaacggatttca
agcggagtgcacgagctaatacaaaatgtcagagacgctcgcgggtcaccaatacctctg
ccgaatatgatttccaattcattgggcaatgtggttaatgatataatttttggatttaaa
tttccactggatgacaaaacttggaagtggttcagacaaatccaagaagagggatgtcat
gaaatgggtgtagcaggcgttgttaattttttaccttttatacgattaatatctccatcc
actcaaaaaactatgaaagtgcttgtccgcggccaagctcaaacacatagactatacgcg
agtattattgcaaaacgccgaaagatgctgggcttacaagtgccaccaaaagctatacat
atagaacatgaaaatatattcaatgatcatcccgaaggattcataaaatgtatcaaatac
agtaaacacgcatcgaatactgaagttcattattttgaccccaaagttctgataccctcg
aatgatgaatgtatcatggatagttttctggcggaacaaaagagaagatacgagaatgga
gaggagaacgcttattttatgagagacgagcaaatgcattatcttctagcagacatgttc
ggtgcaggcttggacactactgctgttacattttcgtgggtcttattatacatgtccctg
tatactgaagtccaagaaaaagtgcgagaagaaatattatccgtatacccggaagaatgt
gaagtggatagtgcaaaactgccttatctcacggcagtcatctgtgagactcaacgcatc
agatctatcgtacctgttggtatacctcatggatgcttacaagatactttcttgggaaat
tatcgaataccaaagggaacaatggtagtaccattgcagtgggcagttcacatggatcca
gacgtgtgggaagatcccgagagcttcaatccaaaccgatttattgatgaccgaggagaa
ttgttgaagccccaggagtttataccttttcaaactggtaaaagaatgtgccctggagat
gagctatcgcgtatgttgacagtaggcttgataactcgacttctgcgtgactttagaatt
cgtttatcgtcagatccaccgaccgctgaggaaatgaagggtgaagttggcattgtcctg
accccaccaaaagtcctatatatttgcgaacctatcacttaa

DBGET integrated database retrieval system