Bartonella apihabitans: BBC0178_008570 Help Entry BBC0178_008570    CDS       T08729                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bapa  Bartonella apihabitans Pathway bapa01100   Metabolic pathways bapa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bapa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBC0178_008570    00074 Mycolic acid biosynthesis     BBC0178_008570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBC0178_008570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AQT42347 UniProt:  A0A1U9MAL9 LinkDB All DBs Position 956695..956931 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVIEHLGVDANKVTENASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatacagcagaacgcgtcaagaaaatcgtcatcgaacatcttggtgttgatgca aataaagtaaccgaaaacgcaagtttcattgacgatcttggtgccgatagtcttgacacc gtagaattggtcatggcttttgaagaagaattcggtgtagaaattccggacgacgctgcc gaaaccattttgaccgttggcgatgcagtcaagtttattgacaaggcttcggcctga

DBGET integrated database retrieval system