Bartonella apis: BBC0122_009460 Help Entry BBC0122_009460    CDS       T05086                                  Name (GenBank) bacterial nucleoid protein Hbs   KO K03530   DNA-binding protein HU-beta Organism bapi  Bartonella apis Brite KEGG Orthology (KO) [BR:bapi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bapi03032]     BBC0122_009460    03036 Chromosome and associated proteins [BR:bapi03036]     BBC0122_009460    03400 DNA repair and recombination proteins [BR:bapi03400]     BBC0122_009460 DNA replication proteins [BR:bapi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BBC0122_009460 Chromosome and associated proteins [BR:bapi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BBC0122_009460 DNA repair and recombination proteins [BR:bapi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BBC0122_009460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 Motif Other DBs NCBI-ProteinID:  AQT47072 UniProt:  A0A1U9MHC1 LinkDB All DBs Position 1090893..1091171 Genome browser AA seq 92 aa AA seqDB search MNKNELVSSVAEKAGITKTQAASAVDAFIASVTDALKDGGDVRLPGFGSFEVSHRAATKG RNPSTGAEINIPARNVPKFSAGKGLKDAVNSK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaataagaacgaattggtcagctctgtagctgaaaaagccggcataacaaaaacgcaa gctgcttcggctgtggacgccttcattgcttccgttaccgatgctttgaaagatggcggt gacgttcgtcttcccggattcggttcatttgaagtttcccaccgtgcggctacaaaagga cgcaatccttctactggcgcagaaatcaacattcctgcccgcaacgttccgaagttttcg gccggtaaaggcttgaaggacgccgtcaacagtaaataa

DBGET integrated database retrieval system