Ditibartonella choladocola: BBC0122_020350 Help Entry BBC0122_020350    CDS       T05086                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism bapi  Ditibartonella choladocola Pathway bapi00190   Oxidative phosphorylation bapi01100   Metabolic pathways bapi02020   Two-component system Module bapi_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:bapi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BBC0122_020350  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BBC0122_020350 Enzymes [BR:bapi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BBC0122_020350 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AQT48128 UniProt:  A0A1U9MK71 LinkDB All DBs Position 2421565..2421690 Genome browser AA seq 41 aa AA seqDB search MWYFSWALGLPLAAAFAILNAMWYELTDDSAKQNKGENKSE NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcatgggctctcggccttccgcttgctgccgctttcgcaatattgaat gcgatgtggtatgaattgacggacgacagcgccaaacaaaataaaggcgagaataaatcc gaatag

DBGET integrated database retrieval system