Bacillus velezensis CAU B946: BACAU_3442 Help Entry BACAU_3442        CDS       T01692                                  Symbol ywlF Name (GenBank) ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism baq  Bacillus velezensis CAU B946 Pathway baq00030   Pentose phosphate pathway baq00051   Fructose and mannose metabolism baq00710   Carbon fixation by Calvin cycle baq01100   Metabolic pathways baq01110   Biosynthesis of secondary metabolites baq01120   Microbial metabolism in diverse environments baq01200   Carbon metabolism baq01230   Biosynthesis of amino acids Module baq_M00004   Pentose phosphate pathway (Pentose phosphate cycle) baq_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:baq00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     BACAU_3442 (ywlF)    00051 Fructose and mannose metabolism     BACAU_3442 (ywlF)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     BACAU_3442 (ywlF) Enzymes [BR:baq01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      BACAU_3442 (ywlF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  CCF06976 LinkDB All DBs Position complement(3640275..3640724) Genome browser AA seq 149 aa AA seqDB search MKVAIASDHGGVHIREEIKSLLDELQIEYIDMGCECGAGSVDYSDYAFPVAEKVVNGEAD RGILICGTGIGMSISANKVKGIRCALAHDTFSAKATREHNDTNVLAMGERVIGPGLAREI AKVWLTTEFTGGRHERRIGKIADYEEKNL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtagctattgcgtcagatcacggcggcgtccatatccgcgaagaaataaaaagt cttttggatgaattgcagattgaatacattgatatgggctgtgaatgcggcgccggctct gtcgattattcagactacgcttttccggtagcggaaaaagtggtgaacggcgaagctgac aggggaattttaatttgcggcacaggcatcggcatgagcatctccgcaaataaggtaaag ggcatacgctgtgcgcttgcccatgacaccttcagcgcaaaagcgacgcgtgaacacaat gacacgaatgttcttgcgatgggcgaacgcgtcatcggcccggggctggcgcgcgaaatc gcaaaagtctggctgacgactgaatttacgggcggccgccacgaacggcggatcggcaaa atcgcagattacgaagaaaaaaatctgtaa

DBGET integrated database retrieval system